General Information

  • ID:  hor004631
  • Uniprot ID:  D1FNJ7(130-141)
  • Protein name:  CLE1-1
  • Gene name:  CLE-1
  • Organism:  Globodera rostochiensis (Golden nematode worm) (Heterodera rostochiensis)
  • Family:  CLV3/ESR signal peptide family
  • Source:  animal
  • Expression:  Strongly up-regulated during root colonization, from the onset of syncytium formation by parasitic second-stage juveniles (pJ2) through the J3?J4 molts of sedentary life stages that become adult females. |Highly expressed exclusively within the dorsal eso
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Globodera (genus), Heteroderinae (subfamily), Heteroderidae (family), Tylenchoidea (superfamily), Tylenchomorpha (infraorder), Tylenchina (suborder), Rhabditida (order), Chromadorea (class), Nematoda (phylum), Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  NA
  • GO BP:  GO:0030154 cell differentiation
  • GO CC:  GO:0005576 extracellular region; GO:0030430 host cell cytoplasm; GO:0043655 host extracellular space

Sequence Information

  • Sequence:  RVTPGGPDPLHN
  • Length:  12(130-141)
  • Propeptide:  MAKNAMLCLLILSVVLALAFATNEKDDKEAGNLSTGIFGKAGRFVTVALAMSSRLGGAGASQGGGAVHGESLKSNQLQNAYRMALPPPMQIKSAEIDGWKPSPDEYLKKFAQEFRRNTGMKPQSYNEEKRVTPGGPDPLHNREKILEEQKRVTPGGPDPLHNREKTLEEQKRVTPGGPDPLHNREKTLEEQKRVTPGVPDRQHR
  • Signal peptide:  MAKNAMLCLLILSVVLALAFA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Mimics host plant CLE extracellular signal peptides that regulate cell fate. May play a role in the differentiation or division of feeding cells (syncytia) induced in plant roots during infection.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-D1FNJ7-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor004631_AF2.pdbhor004631_ESM.pdb

    Please select some value
    Remove Label
    Add Label

    Please select some value
    Remove Label
    Add Label

Physical Information

Mass: 145577 Formula: C54H86N18O17
Absent amino acids: ACEFIKMQSWY Common amino acids: P
pI: 7.55 Basic residues: 2
Polar residues: 4 Hydrophobic residues: 2
Hydrophobicity: -108.33 Boman Index: -2667
Half-Life: 1 hour Half-Life Yeast: 2 min
Half-Life E.Coli: 2 min Aliphatic Index 56.67
Instability Index: 2582.5 Extinction Coefficient cystines: 0
Absorbance 280nm: 0

Literature

  • PubMed ID:  21750229
  • Title:  Mechanisms of Molecular Mimicry of Plant CLE Peptide Ligands by the Parasitic Nematode Globodera Rostochiensis